Human TMPRSS2 protein

Produktübersicht

• Artikelname: Human TMPRSS2 protein
• Artikelnummer: BYT-ORB705030
• Hersteller Artikelnummer: orb705030
• Alternativnummer: BYT-ORB705030-20,BYT-ORB705030-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Serine protease 10

Produktbeschreibung

Recombinant Human Transmembrane protease serine 2(TMPRSS2),partial

Produkteigenschaften

• Molekulargewicht: 46.9 kDa
• UniProt: O15393
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration