ACE2 protein

Artikelnummer: BYT-ORB705121
Artikelname: ACE2 protein
Artikelnummer: BYT-ORB705121
Hersteller Artikelnummer: orb705121
Alternativnummer: BYT-ORB705121-20,BYT-ORB705121-100,BYT-ORB705121-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Recombinant Paguma larvata Angiotensin-converting enzyme 2(ACE2),partial
Molekulargewicht: 112.7 kDa
UniProt: Q56NL1
Puffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Quelle: Paguma larvata (Masked palm civet)
Reinheit: Greater than 94.8% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: QSTTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITDENAKNMNEAGAKWSAYYEEQSKLAQTYPLAEIQDAKIKRQLQALQQSGSSVLSADKSQRLNTILNAMSTIYSTGKACNPNNPQECLLLEPGLDNIMENSKDYNERLWAWEGWRAEVGKQLRPLYEEYVALKNEMARANNYEDYGDYWRGDYEEEWTGGYNYSRNQLIQDVEDTFEQIKPLYQHLHAYVRAKLMDTYPSRISRTGCLPAHLLGDMW
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration