Monkey ACE2 protein

Artikelnummer: BYT-ORB705341
Artikelname: Monkey ACE2 protein
Artikelnummer: BYT-ORB705341
Hersteller Artikelnummer: orb705341
Alternativnummer: BYT-ORB705341-20,BYT-ORB705341-100,BYT-ORB705341-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Recombinant Macaca fascicularis Angiotensin-converting enzyme(ACE2),partial
Molekulargewicht: 112.7 kDa
UniProt: A0A2K5X283
Puffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Quelle: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Reinheit: Greater than 93% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGEKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPNNPQECLLLDPGLNEIMEKSLDYNERLWAWEGWRSEVGKQLRPLYEEYVVLKNEMARANHYKDYGDYWRGNYEVNGVDGYDYNRDQLIEDVERTFEEIKPLYEHLHAYVRAKLMNAYPSYISPTGCLPAHLLGDMW
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration