SARS-CoV-2 NSP9 Antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: SARS-CoV-2 NSP9 Antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: BYT-ORB738433
• Hersteller Artikelnummer: orb738433
• Alternativnummer: BYT-ORB738433-10,BYT-ORB738433-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA
• Spezies Reaktivität: Human
• Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
• Konjugation: Unconjugated
• Alternative Synonym: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9, sars-cov-2

Produktbeschreibung

SARS-CoV-2 NSP9 Antibody

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molekulargewicht: 140 kDa, 130 kDa, 110 kDa
• Sensitivitaet: > 5000 cells
• UniProt: P0DTC1
• Puffer: Lyophilized
• Formulierung: Lyophilized

Anwendungsbeschreibung

• Anwendungsbeschreibung: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.