Bacterial adk protein

Artikelnummer: BYT-ORB8234
Artikelname: Bacterial adk protein
Artikelnummer: BYT-ORB8234
Hersteller Artikelnummer: orb8234
Alternativnummer: BYT-ORB8234-20,BYT-ORB8234-100,BYT-ORB8234-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ATP-AMP transphosphorylase ATP, AMP phosphotransferase Adenylate monophosphate kinase
Recombinant of bacterial adk protein
Molekulargewicht: 43.6 kDa
UniProt: Q83M40
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Shigella flexneri
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG
Anwendungsbeschreibung: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-214aaSequence Info: Full LengthGlycerol content: 0.5