Human CCR8 protein

Artikelnummer: BYT-ORB865263
Artikelname: Human CCR8 protein
Artikelnummer: BYT-ORB865263
Hersteller Artikelnummer: orb865263
Alternativnummer: BYT-ORB865263-20,BYT-ORB865263-100,BYT-ORB865263-500,BYT-ORB865263-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (CC chemokine receptor CHEMR1) (CMKBRL2) (Chemokine receptor-like 1) (CKR-L1) (GPR-CY6) (GPRCY6) (TER1) (CDw198) (CKRL1) (CMKBR8) (CMKBRL2)
Recombinant Human C-C chemokine receptor type 8(CCR8)-VLPs (Active)
Molekulargewicht: 42.2 kDa
UniProt: P51685
Puffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Testing in progress.
Formulierung: Lyophilized powder
Sequenz: MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPF
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 mi