Recombinant Human Glial cell line-derived neurotrophic factor protein(GDNF) (Active)

Artikelnummer: CSB-AP002881HU
Artikelname: Recombinant Human Glial cell line-derived neurotrophic factor protein(GDNF) (Active)
Artikelnummer: CSB-AP002881HU
Hersteller Artikelnummer: CSB-AP002881HU
Alternativnummer: CSB-AP002881HU-500, CSB-AP002881HU-100, CSB-AP002881HU-10
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: hGDNF, ATF
Molekulargewicht: 15.1 kDa
Tag: Tag-Free
UniProt: P39905
Puffer: Lyophilized from a 0.2 µm filtered 1 * PBS, pH 7.4, with 0.05 % Tween-20
Quelle: E.Coli
Expression System: 78-211aa
Reinheit: >97% as determined by SDS-PAGE and HPLC.
Formulierung: Lyophilized powder
Sequenz: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI