Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)

Artikelnummer: CSB-AP003861HU
Artikelname: Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)
Artikelnummer: CSB-AP003861HU
Hersteller Artikelnummer: CSB-AP003861HU
Alternativnummer: CSB-AP003861HU-1,CSB-AP003861HU-500,CSB-AP003861HU-50,CSB-AP003861HU-10
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Transforming Growth Factor Beta-1, TGF-Beta-1, Latency-Associated Peptide, LAP, TGFB1, TGFB
Molekulargewicht: 12.8 kDa
Tag: Tag-Free
UniProt: P01137
Puffer: Lyophilized from a 0.2 µm filtered 50mM Glycine-HCl, 150mMNacl, pH2.5
Quelle: Mammalian cell
Expression System: 279-390aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.