Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)
Artikelnummer:
CSB-AP003861HU
| Artikelname: |
Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active) |
| Artikelnummer: |
CSB-AP003861HU |
| Hersteller Artikelnummer: |
CSB-AP003861HU |
| Alternativnummer: |
CSB-AP003861HU-1,CSB-AP003861HU-500,CSB-AP003861HU-50,CSB-AP003861HU-10 |
| Hersteller: |
Cusabio |
| Kategorie: |
Proteine/Peptide |
| Alternative Synonym: |
Transforming Growth Factor Beta-1, TGF-Beta-1, Latency-Associated Peptide, LAP, TGFB1, TGFB |
| Molekulargewicht: |
12.8 kDa |
| Tag: |
Tag-Free |
| UniProt: |
P01137 |
| Puffer: |
Lyophilized from a 0.2 µm filtered 50mM Glycine-HCl, 150mMNacl, pH2.5 |
| Quelle: |
Mammalian cell |
| Expression System: |
279-390aa |
| Reinheit: |
Greater than 95% as determined by SDS-PAGE. |
| Formulierung: |
Lyophilized powder |
| Sequenz: |
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
![]()
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
