Recombinant Human Thrombopoietin (THPO) (Active)
Artikelnummer:
CSB-AP003971HU
Artikelname: |
Recombinant Human Thrombopoietin (THPO) (Active) |
Artikelnummer: |
CSB-AP003971HU |
Hersteller Artikelnummer: |
CSB-AP003971HU |
Alternativnummer: |
CSB-AP003971HU-1,CSB-AP003971HU-500,CSB-AP003971HU-50,CSB-AP003971HU-10 |
Hersteller: |
Cusabio |
Kategorie: |
Proteine/Peptide |
Alternative Synonym: |
Thrombopoietin,C-mpl ligand,Megakaryocyte colony-stimulating factor,Megakaryocyte growth and development factor,Myeloproliferative leukemia virus oncogene ligand,THPO |
Molekulargewicht: |
37.3 kDa |
Tag: |
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
UniProt: |
P40225 |
Puffer: |
Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
Quelle: |
Mammalian cell |
Expression System: |
22-353aa |
Reinheit: |
Greater than 95% as determined by SDS-PAGE. |
Formulierung: |
Lyophilized powder |
Sequenz: |
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDIS |
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |