Recombinant Human Growth/differentiation factor 5 (GDF5)
Artikelnummer:
CSB-AP005981HU
- Bilder (0)
| Artikelname: | Recombinant Human Growth/differentiation factor 5 (GDF5) |
| Artikelnummer: | CSB-AP005981HU |
| Hersteller Artikelnummer: | CSB-AP005981HU |
| Alternativnummer: | CSB-AP005981HU-500, CSB-AP005981HU-100, CSB-AP005981HU-10 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | BMP14, CDMP1, GDF-5, BMP-14, CDMP-1, LAP-4, LPS-associated protein 4, Radotermin |
| Molekulargewicht: | 13.6 kDa |
| Tag: | Tag-Free |
| UniProt: | P43026 |
| Puffer: | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Quelle: | E.Coli |
| Expression System: | 382-501aa |
| Reinheit: | >95% as determined by SDS-PAGE and HPLC analyses. |
| Formulierung: | Lyophilized powder |
| Sequenz: | APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Produktgarantie und fachkundiger Support
