Recombinant Mouse Anterior gradient protein 2 homolog (Agr2)
Artikelnummer:
CSB-BP001458MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Anterior gradient protein 2 homolog (Agr2) |
| Artikelnummer: | CSB-BP001458MO |
| Hersteller Artikelnummer: | CSB-BP001458MO |
| Alternativnummer: | CSB-BP001458MO-1, CSB-BP001458MO-100, CSB-BP001458MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Protein Gob-4 (Secreted cement gland protein XAG-2 homolog) |
| Molekulargewicht: | 21.8 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | O88312 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 21-175aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL |
Produktgarantie und fachkundiger Support
