Recombinant Human Complement C1q subcomponent subunit A (C1QA)
Artikelnummer:
CSB-BP003637HU
- Bilder (0)
| Artikelname: | Recombinant Human Complement C1q subcomponent subunit A (C1QA) |
| Artikelnummer: | CSB-BP003637HU |
| Hersteller Artikelnummer: | CSB-BP003637HU |
| Alternativnummer: | CSB-BP003637HU-1, CSB-BP003637HU-100, CSB-BP003637HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | C1qa, C1QA_HUMAN, Complement C1q subcomponent subunit A, Complement component 1 q subcomponent A chain, Complement component 1 q subcomponent alpha polypeptide, Complement component C1q A chain |
| Molekulargewicht: | 27.7 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P02745 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 23-245aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA |
Produktgarantie und fachkundiger Support
