Recombinant Human Complement component C8 gamma chain (C8G)
Artikelnummer:
CSB-BP004196HU
- Bilder (0)
| Artikelname: | Recombinant Human Complement component C8 gamma chain (C8G) |
| Artikelnummer: | CSB-BP004196HU |
| Hersteller Artikelnummer: | CSB-BP004196HU |
| Alternativnummer: | CSB-BP004196HU-1, CSB-BP004196HU-100, CSB-BP004196HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | C8C, C8G, CO8G_HUMAN, Complement component 8 gamma polypeptide, Complement component C8 gamma chain, MGC142186 |
| Molekulargewicht: | 22.9 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P07360 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 21-202aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
Produktgarantie und fachkundiger Support
