Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1)
Artikelnummer:
CSB-BP004806HU
- Bilder (0)
| Artikelname: | Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1) |
| Artikelnummer: | CSB-BP004806HU |
| Hersteller Artikelnummer: | CSB-BP004806HU |
| Alternativnummer: | CSB-BP004806HU-1, CSB-BP004806HU-100, CSB-BP004806HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | CCNB 1, CCNB, ccnb1, CCNB1_HUMAN, Cyclin B1, G2 mitotic specific cyclin B1 , G2/mitotic-specific cyclin-B1 |
| Molekulargewicht: | 52.3 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P14635 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 1-433aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFI |
Produktgarantie und fachkundiger Support
