Recombinant Human Cyclin-dependent kinase4 (CDK4)

Produktübersicht

• Artikelname: Recombinant Human Cyclin-dependent kinase4 (CDK4)
• Artikelnummer: CSB-BP005065HU
• Hersteller Artikelnummer: CSB-BP005065HU
• Alternativnummer: CSB-BP005065HU-1, CSB-BP005065HU-100, CSB-BP005065HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cyclin-dependent kinase 4 Cyclin-dependent kinase 4, isoform CRA_c

Produkteigenschaften

• Molekulargewicht: 35.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P11802
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 2-303aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPR