Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial

Produktübersicht

• Artikelname: Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial
• Artikelnummer: CSB-BP005389HU1
• Hersteller Artikelnummer: CSB-BP005389HU1
• Alternativnummer: CSB-BP005389HU1-1, CSB-BP005389HU1-100, CSB-BP005389HU1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ACHA3_HUMAN, AChR, Cholinergic receptor neuronal nicotinic alpha polypeptide 3, Cholinergic receptor nicotinic alpha 3, Cholinergic receptor nicotinic alpha polypeptide 3, CHRNA 3, CHRNA3, LNCR2, MGC104879, NACHRA 3, NACHRA3, Neuronal acetylcholine recep

Produkteigenschaften

• Molekulargewicht: 26.6 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: P32297
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 32-240aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL