Recombinant Human Ciliary neurotrophic factor (CNTF)

Artikelnummer: CSB-BP005683HU
Artikelname: Recombinant Human Ciliary neurotrophic factor (CNTF)
Artikelnummer: CSB-BP005683HU
Hersteller Artikelnummer: CSB-BP005683HU
Alternativnummer: CSB-BP005683HU-1, CSB-BP005683HU-100, CSB-BP005683HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: CNTF
Molekulargewicht: 26.8 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P26441
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Baculovirus
Expression System: 1-200aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM