Recombinant Human Carboxypeptidase D (CPD), partial
Artikelnummer:
CSB-BP005885HU1
- Bilder (0)
| Artikelname: | Recombinant Human Carboxypeptidase D (CPD), partial |
| Artikelnummer: | CSB-BP005885HU1 |
| Hersteller Artikelnummer: | CSB-BP005885HU1 |
| Alternativnummer: | CSB-BP005885HU1-1, CSB-BP005885HU1-100, CSB-BP005885HU1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Metallocarboxypeptidase D gp180,CSB-PR2024 |
| Molekulargewicht: | 12.3 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | O75976 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 383-461aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP |
Produktgarantie und fachkundiger Support
