Recombinant Human Cathepsin O (CTSO)
Artikelnummer:
CSB-BP006203HU
- Bilder (0)
| Artikelname: | Recombinant Human Cathepsin O (CTSO) |
| Artikelnummer: | CSB-BP006203HU |
| Hersteller Artikelnummer: | CSB-BP006203HU |
| Alternativnummer: | CSB-BP006203HU-1, CSB-BP006203HU-100, CSB-BP006203HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | CTSO1,CSB-PR2024 |
| Molekulargewicht: | 67.5 kDa |
| Tag: | N-terminal MBP-tagged and C-terminal 6xHis-tagged |
| UniProt: | P43234 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 108-321aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV |
Produktgarantie und fachkundiger Support
