Recombinant Human Cytoplasmic dynein 1 intermediate chain 1 (DYNC1I1)

Artikelnummer: CSB-BP007293HU
Artikelname: Recombinant Human Cytoplasmic dynein 1 intermediate chain 1 (DYNC1I1)
Artikelnummer: CSB-BP007293HU
Hersteller Artikelnummer: CSB-BP007293HU
Alternativnummer: CSB-BP007293HU-1, CSB-BP007293HU-100, CSB-BP007293HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Cytoplasmic dynein intermediate chain 1 Dynein intermediate chain 1, cytosolic
Molekulargewicht: 75.4 kDa
Tag: N-terminal 10xHis-tagged
UniProt: O14576
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Baculovirus
Expression System: 1-645aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFD