Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Produktübersicht

• Artikelname: Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)
• Artikelnummer: CSB-BP007399HU
• Hersteller Artikelnummer: CSB-BP007399HU
• Alternativnummer: CSB-BP007399HU-1, CSB-BP007399HU-100, CSB-BP007399HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Developmentally-regulated endothelial cell locus 1 protein)(Integrin-binding protein DEL1),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 57.0 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: O43854
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 24-480aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDN