Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)

Produktübersicht

• Artikelname: Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)
• Artikelnummer: CSB-BP007589HU
• Hersteller Artikelnummer: CSB-BP007589HU
• Alternativnummer: CSB-BP007589HU-1, CSB-BP007589HU-100, CSB-BP007589HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Elastase IIIB (Elastase-3B) (Protease E) (ELA3B),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 28.8 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P08861
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 29-270aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH