Recombinant Rat Ectonucleoside triphosphate diphosphohydrolase 1 (Entpd1), partial
Artikelnummer:
CSB-BP007690RA
- Bilder (0)
| Artikelname: | Recombinant Rat Ectonucleoside triphosphate diphosphohydrolase 1 (Entpd1), partial |
| Artikelnummer: | CSB-BP007690RA |
| Hersteller Artikelnummer: | CSB-BP007690RA |
| Alternativnummer: | CSB-BP007690RA-1, CSB-BP007690RA-100, CSB-BP007690RA-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Ecto-ATP diphosphohydrolase 1 (Ecto-ATPDase 1) (Ecto-ATPase 1) (Ecto-apyrase) (Lymphoid cell activation antigen) (CD_antigen: CD39) (NTPDase 1) (Cd39),CSB-PR2024 |
| Molekulargewicht: | 50.9 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P97687 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 38-479aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | THNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQLLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLNFISDSQKQATFGALDLGGSSTQVTFVPLNQTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVN |
Produktgarantie und fachkundiger Support
