Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R)

Produktübersicht

• Artikelname: Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R)
• Artikelnummer: CSB-BP008789HU
• Hersteller Artikelnummer: CSB-BP008789HU
• Alternativnummer: CSB-BP008789HU-1, CSB-BP008789HU-100, CSB-BP008789HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Folate receptor 4)(Folate receptor delta)(FR-delta)(IZUMO1 receptor protein JUNO),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 27.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: A6ND01
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 20-250aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS