Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA)

Produktübersicht

• Artikelname: Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA)
• Artikelnummer: CSB-BP009053HUV
• Hersteller Artikelnummer: CSB-BP009053HUV
• Alternativnummer: CSB-BP009053HUV-1, CSB-BP009053HUV-100, CSB-BP009053HUV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: pfr

Produkteigenschaften

• Molekulargewicht: 21.8 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P52093
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1-167aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS