Recombinant Human Kelch domain-containing protein 3 (KLHDC3)

Produktübersicht

• Artikelname: Recombinant Human Kelch domain-containing protein 3 (KLHDC3)
• Artikelnummer: CSB-BP858414HU
• Hersteller Artikelnummer: CSB-BP858414HU
• Alternativnummer: CSB-BP858414HU-1, CSB-BP858414HU-100, CSB-BP858414HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein Peas (Testis intracellular mediator protein) (PEAS),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 47.0 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q9BQ90
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1-382aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIF