Recombinant Mouse Complement C1q-like protein 3 (C1ql3)

Produktübersicht

• Artikelname: Recombinant Mouse Complement C1q-like protein 3 (C1ql3)
• Artikelnummer: CSB-BP863674MOB1
• Hersteller Artikelnummer: CSB-BP863674MOb1
• Alternativnummer: CSB-BP863674MOB1-1, CSB-BP863674MOB1-100, CSB-BP863674MOB1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: C1q and tumor necrosis factor-related protein 13 (C1q/TNF-related protein 13) (CTRP13) (Gliacolin) (C1ql) (Ctrp13),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 28.6 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q9ESN4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 21-255aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD