Recombinant Rat E3 ubiquitin-protein ligase parkin (Prkn)

Produktübersicht

• Artikelname: Recombinant Rat E3 ubiquitin-protein ligase parkin (Prkn)
• Artikelnummer: CSB-BP864348RA
• Hersteller Artikelnummer: CSB-BP864348RA
• Alternativnummer: CSB-BP864348RA-1, CSB-BP864348RA-100, CSB-BP864348RA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Parkin RBR E3 ubiquitin-protein ligase,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 55.6 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q9JK66
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1-465aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MIVFVRFNSSYGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNHLTVQNCDLEQQSIVHIVQRPQRKSHETNASGGDKPQSTPEGSIWEPRSLTRVDLSSHILPADSVGLAVILDTDSKSDSEAARGPEAKPTYHSFFVYCKGPCHKVQPGKLRVQCGTCRQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITNNSRSIPCIACTDVRNPVLVFQCN