Recombinant Human Poly [ADP-ribose] polymerase 2 (PARP2)
Artikelnummer:
CSB-BP866224HU
- Bilder (0)
| Artikelname: | Recombinant Human Poly [ADP-ribose] polymerase 2 (PARP2) |
| Artikelnummer: | CSB-BP866224HU |
| Hersteller Artikelnummer: | CSB-BP866224HU |
| Alternativnummer: | CSB-BP866224HU-1, CSB-BP866224HU-100, CSB-BP866224HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (PARP-2)(hPARP-2)(ADP-ribosyltransferase diphtheria toxin-like 2)(ARTD2)(DNA ADP-ribosyltransferase PARP2)(NAD(+)(ADPRT-2)(Poly[ADP-ribose] synthase 2)(pADPRT-2)(Protein poly-ADP-ribosyltransferase PARP2) |
| Molekulargewicht: | 71.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9UGN5 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 1-583aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKDRTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQELIKLICNVQAMEEM |
Produktgarantie und fachkundiger Support
