Recombinant Rat Mannan-binding lectin serine protease 2 (Masp2)
Artikelnummer:
CSB-BP867502RA
- Bilder (0)
| Artikelname: | Recombinant Rat Mannan-binding lectin serine protease 2 (Masp2) |
| Artikelnummer: | CSB-BP867502RA |
| Hersteller Artikelnummer: | CSB-BP867502RA |
| Alternativnummer: | CSB-BP867502RA-1, CSB-BP867502RA-100, CSB-BP867502RA-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | MBL-associated serine protease 2,Mannose-binding protein-associated serine protease 2,MASP-2 |
| Molekulargewicht: | 79.2 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9JJS8 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 20-685aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SKWPEPVFGRLVSLGFPEKYGNHQDRSWTLTAPPGFRLRLYFTHFNLELSYRCEYDFVKLTSGTKVLATLCGQESTDTERAPGNDTFYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAEDVDECRTSLGDSVPCDHYCHNYLGGYYCSCRVGYILHQNKHTCSALCSGQVFTGRSGFLSSPEYPQPYPKLSSCAYNIRLEEGFSITLDFVESFDVEMHPEAQCPYDSLKIQTDKREYGPFCGKTLPPRIETDSNK |
Produktgarantie und fachkundiger Support
