Recombinant Human Band 4.1-like protein 5 (EPB41L5)

Produktübersicht

• Artikelname: Recombinant Human Band 4.1-like protein 5 (EPB41L5)
• Artikelnummer: CSB-BP872549HUB0
• Hersteller Artikelnummer: CSB-BP872549HUb0
• Alternativnummer: CSB-BP872549HUB0-1, CSB-BP872549HUB0-100, CSB-BP872549HUB0-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Erythrocyte membrane protein band 4.1-like 5),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 84.3 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: Q9HCM4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1-733aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEPNNLREELTRYLFVLQLKQDILSGKLDCPFDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGV