Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)

Produktübersicht

• Artikelname: Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)
• Artikelnummer: CSB-BP873379DOA
• Hersteller Artikelnummer: CSB-BP873379DOA
• Alternativnummer: CSB-BP873379DOA-1, CSB-BP873379DOA-100, CSB-BP873379DOA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Hydroxycinnamate 4-beta-glucosyltransferase UGT72E2,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 56.9 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q9LVR1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1-481aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MHITKPHAAMFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGVDIVKLPSPDIYGLVDPDDHVVTKIGVIMRAAVPALRSKIAAMHQKPTALIVDLFGTDALCLAKEFNMLSYVFIPTNARFLGVSIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDAYLVPDEPVYRDFVRHGLAYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPVYPIGPLCRPIQSSETDHPVL