Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

Produktübersicht

• Artikelname: Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)
• Artikelnummer: CSB-BP875360MO
• Hersteller Artikelnummer: CSB-BP875360MO
• Alternativnummer: CSB-BP875360MO-1, CSB-BP875360MO-100, CSB-BP875360MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 26.6 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: Q9ES30
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 23-246aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK