Recombinant Human Insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1)

Artikelnummer: CSB-BP878937HU
Artikelname: Recombinant Human Insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1)
Artikelnummer: CSB-BP878937HU
Hersteller Artikelnummer: CSB-BP878937HU
Alternativnummer: CSB-BP878937HU-1, CSB-BP878937HU-100, CSB-BP878937HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (IGF2 mRNA-binding protein 1)(IMP-1)(IMP1)(Coding region determinant-binding protein)(CRD-BP)(IGF-II mRNA-binding protein 1)(VICKZ family member 1)(Zipcode-binding protein 1)(ZBP-1),CSB-PR2024
Molekulargewicht: 69.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9NZI8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Baculovirus
Expression System: 1-577aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCS