Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4 (LGR4), partial

Produktübersicht

• Artikelname: Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4 (LGR4), partial
• Artikelnummer: CSB-BP883618HU
• Hersteller Artikelnummer: CSB-BP883618HU
• Alternativnummer: CSB-BP883618HU-1, CSB-BP883618HU-100, CSB-BP883618HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Leucine-rich repeat-containing G-protein coupled receptor 4(G-protein coupled receptor 48)

Produkteigenschaften

• Molekulargewicht: 62.8 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q9BXB1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 25-544aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIH