Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)

Produktübersicht

• Artikelname: Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)
• Artikelnummer: CSB-BP883621HU
• Hersteller Artikelnummer: CSB-BP883621HU
• Alternativnummer: CSB-BP883621HU-1, CSB-BP883621HU-100, CSB-BP883621HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Collagenous repeat-containing sequence 26 kDa protein (CORS26) (Secretory protein CORS26 ) (CTRP3),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 28.1 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q9BXJ4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 23-246aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK