Recombinant Human Protein lin-28 homolog A (LIN28A), partial

Produktübersicht

• Artikelname: Recombinant Human Protein lin-28 homolog A (LIN28A), partial
• Artikelnummer: CSB-BP884500HU2
• Hersteller Artikelnummer: CSB-BP884500HU2
• Alternativnummer: CSB-BP884500HU2-1, CSB-BP884500HU2-100, CSB-BP884500HU2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Zinc finger CCHC domain-containing protein 1,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 12.2 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9H9Z2
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 113-209aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN