Recombinant Arabidopsis thaliana Glucan endo-1,3-beta-glucosidase 10 (At5g42100)

Produktübersicht

• Artikelname: Recombinant Arabidopsis thaliana Glucan endo-1,3-beta-glucosidase 10 (At5g42100)
• Artikelnummer: CSB-BP887760DOA1
• Hersteller Artikelnummer: CSB-BP887760DOA1
• Alternativnummer: CSB-BP887760DOA1-1, CSB-BP887760DOA1-100, CSB-BP887760DOA1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ((1->3)-beta-glucan endohydrolase 10)((1->3)-beta-glucanase 10)(Beta-1,3-endoglucanase 10)(Beta-1,3-glucanase 10)(Putative plasmodesmal associated protein)(AtBG_ppap)

Produkteigenschaften

• Molekulargewicht: 71.5 kDa
• Tag: N-terminal 6xHis-EGFP-tagged
• UniProt: Q9FHX5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 27-425aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGA