Recombinant Human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial (ISCU)
Artikelnummer:
CSB-BP887955HU
- Bilder (0)
| Artikelname: | Recombinant Human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial (ISCU) |
| Artikelnummer: | CSB-BP887955HU |
| Hersteller Artikelnummer: | CSB-BP887955HU |
| Alternativnummer: | CSB-BP887955HU-1, CSB-BP887955HU-100, CSB-BP887955HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN) |
| Molekulargewicht: | 18.3 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9H1K1 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 35-167aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
Produktgarantie und fachkundiger Support
