Recombinant Human Actin-like protein 8 (ACTL8)

Produktübersicht

• Artikelname: Recombinant Human Actin-like protein 8 (ACTL8)
• Artikelnummer: CSB-BP887982HU
• Hersteller Artikelnummer: CSB-BP887982HU
• Alternativnummer: CSB-BP887982HU-1, CSB-BP887982HU-100, CSB-BP887982HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cancer/testis antigen 57 (CT57),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 45.4 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q9H568
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1-366aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRV