Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

Produktübersicht

• Artikelname: Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial
• Artikelnummer: CSB-BP890933HU
• Hersteller Artikelnummer: CSB-BP890933HU
• Alternativnummer: CSB-BP890933HU-1, CSB-BP890933HU-100, CSB-BP890933HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: RING finger protein 203 Zinc/RING finger protein 3,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 23.8 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q9ULT6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 56-219aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM