Recombinant Human Sal-like protein 4 (SALL4), partial
Artikelnummer:
CSB-BP892126HU(M)
- Bilder (0)
| Artikelname: | Recombinant Human Sal-like protein 4 (SALL4), partial |
| Artikelnummer: | CSB-BP892126HU(M) |
| Hersteller Artikelnummer: | CSB-BP892126HU(M) |
| Alternativnummer: | CSB-BP892126HU(M)-1, CSB-BP892126HU(M)-100, CSB-BP892126HU(M)-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Zinc finger protein 797 (Zinc finger protein SALL4) (ZNF797) |
| Molekulargewicht: | 16.0 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9UJQ4 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Baculovirus |
| Expression System: | 954-1053aa+11R |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS |
Produktgarantie und fachkundiger Support
