Recombinant Human Serine/arginine repetitive matrix protein 2 (SRRM2), partial

Produktübersicht

• Artikelname: Recombinant Human Serine/arginine repetitive matrix protein 2 (SRRM2), partial
• Artikelnummer: CSB-BP892369HU
• Hersteller Artikelnummer: CSB-BP892369HU
• Alternativnummer: CSB-BP892369HU-1, CSB-BP892369HU-100, CSB-BP892369HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 300 kDa nuclear matrix antigen (Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa) (SR-related nuclear matrix protein of 300 kDa) (Ser/Arg-related nuclear matrix protein of 300 kDa) (Splicing coactivator subunit SRm300) (Tax-

Produkteigenschaften

• Molekulargewicht: 53.8 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q9UQ35
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1666-2089aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVS