Recombinant Drosophila melanogaster Probable insulin-like peptide 7 (Ilp7)

Produktübersicht

• Artikelname: Recombinant Drosophila melanogaster Probable insulin-like peptide 7 (Ilp7)
• Artikelnummer: CSB-BP895238DLU
• Hersteller Artikelnummer: CSB-BP895238DLU
• Alternativnummer: CSB-BP895238DLU-1, CSB-BP895238DLU-100, CSB-BP895238DLU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Insulin-related peptide 7,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 19.3 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: Q9W4Q9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 32-159aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LQHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY