Recombinant Human PRELI domain containing protein 3B (PRELID3B)

Produktübersicht

• Artikelname: Recombinant Human PRELI domain containing protein 3B (PRELID3B)
• Artikelnummer: CSB-BP896708HU
• Hersteller Artikelnummer: CSB-BP896708HU
• Alternativnummer: CSB-BP896708HU-1, CSB-BP896708HU-100, CSB-BP896708HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein slowmo homolog 2

Produkteigenschaften

• Molekulargewicht: 27.1 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q9Y3B1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1-194aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVVDPVEKTMELKSTNISFTNMVSVDERLIYKPHPQDPEKTVLTQEAIITVKGVSLSSYLEGLMASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK