Recombinant Human Meiotic recombination protein SPO11 (SPO11)

Produktübersicht

• Artikelname: Recombinant Human Meiotic recombination protein SPO11 (SPO11)
• Artikelnummer: CSB-BP897506HU
• Hersteller Artikelnummer: CSB-BP897506HU
• Alternativnummer: CSB-BP897506HU-1, CSB-BP897506HU-100, CSB-BP897506HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Cancer/testis antigen 35)(CT35),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 47.3 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q9Y5K1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 1-396aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPD