Recombinant Human ATP-binding cassette sub-family D member 3 (ABCD3)

Produktübersicht

• Artikelname: Recombinant Human ATP-binding cassette sub-family D member 3 (ABCD3)
• Artikelnummer: CSB-CF001074HU
• Hersteller Artikelnummer: CSB-CF001074HU
• Alternativnummer: CSB-CF001074HU-100, CSB-CF001074HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (70 kDa peroxisomal membrane protein)(PMP70),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 81.5 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P28288
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-659aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKRYLLNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLVVSGLFLTRLRRPIGKM