Recombinant Human Adiponectin receptor protein 1 (ADIPOR1)

Produktübersicht

• Artikelname: Recombinant Human Adiponectin receptor protein 1 (ADIPOR1)
• Artikelnummer: CSB-CF001367HU
• Hersteller Artikelnummer: CSB-CF001367HU
• Alternativnummer: CSB-CF001367HU-100, CSB-CF001367HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Progestin and adipoQ receptor family member I

Produkteigenschaften

• Molekulargewicht: 62.6 kDa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• UniProt: Q96A54
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-375aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQ