Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Produktübersicht

• Artikelname: Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)
• Artikelnummer: CSB-CF001625HU
• Hersteller Artikelnummer: CSB-CF001625HU
• Alternativnummer: CSB-CF001625HU-100, CSB-CF001625HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: FLAP MK-886-binding protein,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 34.2 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P20292
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-161aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP