Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)

Produktübersicht

• Artikelname: Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)
• Artikelnummer: CSB-CF002370HU(A4)
• Hersteller Artikelnummer: CSB-CF002370HU(A4)
• Alternativnummer: CSB-CF002370HU(A4)-100, CSB-CF002370HU(A4)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (ATP synthase membrane subunit f),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 12.4 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P56134
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-94aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH